PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00139188001
Common NameGSBRNA2T00139188001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 355aa    MW: 40384.2 Da    PI: 7.0734
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00139188001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.9e-32196251156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W++eLH+rF++a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00139188001 196 KQRRCWSHELHRRFLNALKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 251
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-28192254IPR009057Homeodomain-like
PROSITE profilePS5129415.454193253IPR017930Myb domain
SuperFamilySSF466898.07E-18194254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-27196251IPR006447Myb domain, plants
PfamPF002496.4E-7198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MIKSLSNMMK YNEKREKCCE YIEALEEERR KINVFQRELP LCLELVTRAI EAYKKEISGT  60
TTDTLYGQPE CSEQTTGECG PVLDLFLPVK QSSASTDEEE EEVYEDDDVE HESHDTGIDF  120
VDKNMKSEWL KSVQLWNQPE AVPVSKSERS QQETQTVVEP IKENDNGAGS HQPPCYEMSN  180
EKNDYIISLA TTRQRKQRRC WSHELHRRFL NALKQLGGPH VATPKQIREL MKVDGLTNDE  240
VKSHLQKYRL HTRRPSQTIP NNRDSQTQHF VVVGGIWVPQ ANHSKANAVA SRKTTTGIYG  300
PMVSPLPSEW PSHSNFGREI SEERSRCSNK GIVRCSSPAM SSSTRTKTKN SKLS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00139188001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0855701e-127AY085570.1 Arabidopsis thaliana clone 157740 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596362.10.0PREDICTED: probable transcription factor KAN3 isoform X1
TrEMBLA0A078D5G70.0A0A078D5G7_BRANA; BnaC07g22940D protein
STRINGBra025161.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136001827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25790.11e-167G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]